1. Notes: 5 / 1 day ago  from populationgo

    populationgo:

    Opening Your Day: Blaster Master

    And you thought your day started off weird.

  2. Notes: 51 / 1 day ago  from tinycartridge

    tinycartridge:

    Comparing Nintendo Power’s Castlevania: Mirror of Fate and Simon’s Quest covers — Mirror of Fate’s art is great, but the latter cover is unforgettable.

    So the latest NP formally reveals Castlevania: Mirror of Fate, a new 3DS entry for Konami’s vampire vanquishing series, from Spanish developer Mercury Steam. As indicated by the full title on NP’s cover, the game is related to Mercury Steam’s Lords of Shadow games that came out in 2010.

    Judging by the initial Mirror of Fate screenshots scanned and posted online, this looks like a 2.5D platformer, and not the sprite-based 2D affairs we’re used to.

    Buy: Castlevania games
See also: More Castlevania posts
[Via FallingEdge]
  3. Notes: 97 / 1 day ago  from iamnedstarksmissinghead (originally from blog-of-thrones)

    (Source: blog-of-thrones)

     
  4. Notes: 122 / 2 days ago  from vgjunk
    vgjunk: Nintendo Cereal System. This stuff was awesome. I miss this cereal so much!

    vgjunk:

    Nintendo Cereal System.

    This stuff was awesome. I miss this cereal so much!

     
  5. Notes: 2 / 2 days ago 

    tristtrist asked: What do you mean by "only deal in absolute truths"?

    I’m just going to leave this here…

  6. Notes: 29 / 2 days ago  from tristtrist (originally from tristtrist)

    tristtrist:

    m-paoword:

    Did you not just read what Ryley wrote? What’s the point in showing a battle we know the outcome of?

    I don’t think you mean to say that? Isn’t that like implying that the final fight against Luffy v bad antagonist should never be shown when we know he will win? All battles, with characters we care about,  ought to be shown, manga writers shouldn’t be selective in which fights get panel time.

    They’ve arrived at Punk Hazard and see what was left of the island after the battle. They were told how the battle ended with Aokiji losing to Akainu and Akainu assuming the title of Fleet Admiral. So what’s the point in showing a fight that’s already have a clear, defined and distinct outcome when it doesn’t further the story at all? Therefore, it is fluff and unnecessary. Oda did all that was necessary in establishing to site for this current arc, giving the island its origin and reason for why the Strawhat crew have encountered who they encountered on this island and nothing else from that fight affects what’s happening now.

    I have to disagree. That’s virtually like saying anything that happened in the present must never be revisited via a flashback sequence since it can be considered fluff and unnecessary when we already know the outcome, for example, flashback arc after Marineford, Flashback on Fishman Island. All of this is necessary to having a good story. Punk hazard fight ought to have been shown.

    Well then, Tristan, since you know how to write One Piece better than Oda, why the hell aren’t you in Japan advising on it? I’m sure, since you only deal in absolute truths, that Oda would easily see the error in his ways and hand over the reigns entirely.

  7. Notes: 126 / 2 days ago  from pixandwords (originally from lightningkick)

    (Source: lightningkick)

     
  8. Notes: 4 / 2 days ago  from digifreaks

    digifreaks:

    THAT.FREAKING.CHICKEN.

    I LAUGHED OUT LOUD AT THE END.

    Spider Cock.

  9. Notes: 114 / 2 days ago  from drvalkyrie (originally from saveroomminibar)

    When and Where to watch the E3 Press Conferences;

    drvalkyrie:

    saveroomminibar:

    Ladies and Gentlemen, E3, the most important event of the gaming year, is only a stones throw away, and giant bomb has put together a list of times and web-locations to watch this years press conferences from the dudes.

    Additionally, all the major gaming websites will be providing coverage of the events there-after across the show floor, showing off the demos and gameplay of the years newly revealed and hyped games. Websites including; GameSpot, Spike TV, G4 including a live feedback from the show floor, IGN as well as youtube, and probably many, many more of your preferred gaming websites. (The Sony and Microsoft conferences will also be available on the respective consoles)

    Below, you can find the show opening conference locations to watch live:

    Monday, June 6, 2011

    Tuesday, June 7, 2011

    Read More

    Hope there’s something good this year

  10. Notes: 29 / 2 days ago  from tristtrist (originally from tristtrist)

    tristtrist:

    ryley-stbatman:

    More than likely we don’t know exactly what happened because Oda deemed that it’s not as important as Luffy’s story in the grand scheme of things, or because he plans on coming back later and having arcs that reveal it to us.

    An important duty for any writer to fulfill is to tell their story without meaningless fluff that there’s essentially no reason for, so if Oda doesn’t see a reason to actually fill in these blanks then he doesn’t have to, it just saves us time so that he can proceed forth rather than looking back. And if he does want us to know what happened then it means there’s a reason he’s not telling us just yet. There’s a reason he never revealed Luffy’s true relation to Ace until later in the series, and why he waited so long to give us that Gaiden arc about them as children. It wouldn’t have fit narratively at that point in the series. It’s a product of actually knowing how to write a good story. 

    There has to be a reason why every and any part of a story is told. If there isn’t a reason why then it shouldn’t be told because that means it doesn’t act as an important spot between point A and B. 

    Then that goes back to one thing I mentioned is a flaw of the series, and that being stuff that should be done on panel being cast aside to be off panel. A recent example, the formation of the conditions of punk hazard being cast aside as just a passing comment and not giving this epic battle time on panel, Zoro and crew defeating opponents off panel, Zoro and crew referencing what they did in the two years being a passing comment and rendered something state off panel.  I think it just shows that a writer has no clue what they want to do and just avoiding it for the sake of convenience. Anything can fit in if its done in a cool, fitting, and fan pleasing manner. It isn’t fluff if it looks and sounds good.

    Quick Question: How many manga/anime/books/etc have you written Tristan?

avatar_128
 
 
I'm that ninja, that nerd, that geek, that otaku, and probably a billion other monikers.

This is the more geeky side of me, and will encompass all things videgames along with whatever else tickles my geek-tastic fancy.

I am a writer over at Population GO contributing to the Gaming section of the site.

My Other Tumblr

Stuff I Made

30 Day Challenge

30 Day Videogame Challenge

Music / trntbl.me

Thanks / Responses

Answers / Questions

XBox 360: I Am That Ninja

Steam: ninjaarashi

Twitter

 
 

Following

restinpeachesactionhankpdpcandaceluciustheninjamaxcapacitym-paowordcaptain-imandigitalhikarilittleyellowboxeslovefailpandanathansmmrsdeathpointmetalhypnotiqlawlskoalaknightdrvalkyriesjhawkinsanimaexnihiloweeaboobiesbrokecorepopulationgoshitdiscosolarstoryemertheschemergeek-artthenocturnaljournalcine31shirtoidmadgearsolidleaguerulesfrownupontinycartridgetristtristtimetravelandrocketpoweredapescaveofcoolneoncircusshiva64pouponvgjunk5tubby1234robotsareawesomeneil-gaimanit8bitthenerdisthewordsjakimjamycatalysttinycakesbloggodariusalphaebonyalienpixandwordsiamnedstarksmissingheadmemetaadigifreakstumblrofthronesmoon-monoliththisisnixofficialspaceshiprocketslavicinfernoallenaokiice-valkyrievampirekittengourmetgamingbrotherbraindcwomenkickingassheebheebryley-stbatmannoirlacredshirtsunitedhwntubitchjhonenvrobocidevideopimpsuper-high-outputpixeltunespteropussecondlifetimesdeath-scythesergberetaformernormaljamieisabamfthe-elder-scrollsthedarknetzwanguyumop-episdnwho5tyxscience-myladygamegifswesterosactanonlemons8bitvisionnousenameheykudaayaaaiherrcamaleoncanadianturdmadeinxvhshitfestcodizzo365crossroadsonehelloworld80percentofthepersonyouloveoiqueconathatmadmanspawnyrebornjellybonesresidentsomakunfatguysfoldermspandrewnomariosspamula27cmshawmangarecommendationsdrumtardmelreviewsmangajustsurrenderheretonightcharonsshipwreckfangamerlcandiainagalaxyfarfarawaytherewassecondlifehungryfreaksdaddypersonasamatheguyverellenwoodyellowjacketguyohyeahfactstomnukimonsterteanesvictorykittyhugzwheresmysuper-suitelitist-movie-snobgoodgameswritingphilnotodevelopermikebraverlimitprobertsonbruceisorangecrypticalconditionjustinrampageiwdrmdbergmarklifeformedgamejournosfragchefblastprocessingwalkingonwoodicodeforlovelovely-imaginationcuntpuntfreakygeekshinixumahixibanaactionfiguretherapynotchkermitlololovejohnonholidayphreaknaturenotosoftcorepewpewreviewsdigitypicalgamesoundsfuckyeahjeebuslcorcoranvecagomezzackpiratekingeuthvilreikandiiholicgo-go-gstdorksplosionlucidthoughtsofakoala-riotvanfuckyeahmashupsjohnbarzlapfoxexistenceearthhearsepartyvertigochickgonzoffitsavulvaalwaysandneverforforeverkushitokikutaopeniswonderfulwhatasmilecanhideafroluffyfuckyeahdtlaadvicefromanon
 

Tumblr